Shipping: Available products typically ship within 24/48h, via priority shipping.
Do you need support? Contact Customer Service or Technical Support.
Online Account
Access or Create Your Account
| Regulatory Status |
RUO – Research Use Only |
|---|
Shipping: Available products typically ship within 24/48h, via priority shipping.
Do you need support? Contact Customer Service or Technical Support.
Online Account
Access or Create Your Account
| Sequence |
MRGSHHHHHHGSGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASG KTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIA ALLSPYSYSTTAVVTNPKE |
|---|---|
| Technical Info / Product Notes |
For the Original Manufacturer’s data sheet please click here. |
| Long Term Storage |
+4°C |
|---|---|
| Shipping |
Blue Ice |
| Regulatory Status |
RUO – Research Use Only |
|---|
Do you want to visit the website?
The products in your cart will be removed.