
Shipping: Available products typically ship within 24/48h, via priority shipping.
Do you need support? Contact Customer Service or Technical Support.
Online Account
Access or Create Your Account
Regulatory Status |
RUO – Research Use Only |
---|
Shipping: Available products typically ship within 24/48h, via priority shipping.
Do you need support? Contact Customer Service or Technical Support.
Online Account
Access or Create Your Account
Sequence |
MRGSHHHHHHGSGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASG KTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIA ALLSPYSYSTTAVVTNPKE |
---|---|
Technical Info / Product Notes |
For the Original Manufacturer’s data sheet please click here. |
Long Term Storage |
+4°C |
---|---|
Shipping |
Blue Ice |
Regulatory Status |
RUO – Research Use Only |
---|
Do you want to visit the website?
The products in your cart will be removed.