Shipping: Available products typically ship within 24/48h, via priority shipping.
Do you need support? Contact Customer Service or Technical Support.
Online Account
Access or Create Your Account
This antibody is covered by our Worry-Free Guarantee.

Product Details
Alternative Name |
TRAIL receptor 3, DcR1, Death Receptor 1, TRID, CD263, TNFRSF 10C, TNF-related apoptosis-inducing ligand receptor 3, Tumor necrosis factor receptor superfamily member 10C |
---|---|
Application |
Flow Cytometry, ICC, IHC (PS), WB |
Application Notes |
Detects a band of ~33kDa by Western blot. |
Formulation |
Liquid. In PBS containing 1mg/ml BSA and 0.1% sodium azide. |
Gene/Protein Identifier |
8794 (Entrez GeneID) |
Host |
Goat |
Immunogen |
Synthetic peptide corresponding to aa 33-63 (E33VPQQTVAPQQQRHSFKGEECPAGSHRSEHT63) of the extracellular domain of human TRAIL-R3. |
Purity Detail |
Epitope-affinity purified IgG. |
Quality Control |
Western blot or Immunocytochemistry on cell lines HEK 293 or Jurkat. |
Recommendation Dilutions/Conditions |
Flow Cytometry (1µl/106 cells/100µl)Immunocytochemistry (1:300),Western Blot (1:1,000)Suggested dilutions/conditions may not be available for all applications.Optimal conditions must be determined individually for each application. |
Species Reactivity |
Human |
UniProt ID |
O14798 |
Worry-free Guarantee |
This antibody is covered by our Worry-Free Guarantee. |
Handling & Storage
Handling |
For maximum product recovery after thawing, centrifuge the vial before opening the cap. Avoid freeze/thaw cycles. After opening, prepare aliquots and store at -20°C. |
---|---|
Long Term Storage |
-20°C |
Shipping |
Blue Ice |
Regulatory Status |
RUO – Research Use Only |
---|
- Effects of androgen ablation therapy in TRAIL death ligand and its receptors expression in advanced prostate cancer: Koksal, I. T., Sanlioglu, A. D., et al.; Urol. Int. 84, 445 (2010), Abstract
- High levels of endogenous tumor necrosis factor-related apoptosis-inducing ligand expression correlate with increased cell death in human pancreas: A.D. Sanlioglu, et al.; Pancreas 36, 385 (2008), Abstract — Full Text
- Lack of tumor necrosis factor-related apoptosis-inducing ligand but presence of its receptors in the human brain: J. Dörr, et al.; J. Neurosci. 22, RC209 (2002), Abstract — Full Text
- The cytokines tumor necrosis factor-alpha (TNF-alpha ) and TNF-related apoptosis-inducing ligand differentially modulate proliferation and apoptotic pathways in human keratinocytes expressing the human papillomavirus-16 E7 oncoprotein: J.R. Basile et al.; J. Biol. Chem. 276, 22522 (2001), Abstract — Full Text
- Rel/NF-κB transcription factors protect against tumor necrosis factor (TNF)-related apoptosis-inducing ligand (TRAIL)-induced apoptosis by up-regulating the TRAIL decoy receptor DcR1: D. Bernard, et al.; J. Biol. Chem. 276, 27322 (2001), Abstract — Full Text
- Sensitivity to TRAIL/APO-2L-mediated apoptosis in human renal cell carcinomas and its enhancement by topotecan: M. Dejosez, et al.; Cell Death Differ. 7, 1127 (2000), Abstract
Related Products

Alternative Name | TRAIL receptor 3, DcR1, Death Receptor 1, TRID, CD263, TNFRSF 10C, TNF-related apoptosis-inducing ligand receptor 3, Tumor necrosis factor receptor superfamily member 10C |
---|---|
Application | Flow Cytometry |
Host | Mouse |
Isotype | IgG1 |
Species Reactivity | Human |
Last modified: May 29, 2024
Datasheet, Manuals, SDS & CofA
Manuals And Inserts
Certificate of Analysis
Please enter the lot number as featured on the product label
SDS
Enzo Life Science provides GHS Compliant SDS
If your language is not available please fill out the SDS request form