Home Shop TRAIL-R3 (human) polyclonal antibody

TRAIL-R3 (human) polyclonal antibody

Already have an account?

Shipping: Available products typically ship within 24/48h, via priority shipping.

Do you need support? Contact Customer Service or Technical Support.

Online Account
Access or Create Your Account

This antibody is covered by our Worry-Free Guarantee.

Alternative Name	TRAIL receptor 3, DcR1, Death Receptor 1, TRID, CD263, TNFRSF 10C, TNF-related apoptosis-inducing ligand receptor 3, Tumor necrosis factor receptor superfamily member 10C
Application	Flow Cytometry, ICC, IHC (PS), WB
Application Notes	Detects a band of ~33kDa by Western blot.
Formulation	Liquid. In PBS containing 1mg/ml BSA and 0.1% sodium azide.
Gene/Protein Identifier	8794 (Entrez GeneID)
Host	Goat
Immunogen	Synthetic peptide corresponding to aa 33-63 (E33VPQQTVAPQQQRHSFKGEECPAGSHRSEHT63) of the extracellular domain of human TRAIL-R3.
Purity Detail	Epitope-affinity purified IgG.
Quality Control	Western blot or Immunocytochemistry on cell lines HEK 293 or Jurkat.
Recommendation Dilutions/Conditions	Flow Cytometry (1µl/106 cells/100µl)Immunocytochemistry (1:300),Western Blot (1:1,000)Suggested dilutions/conditions may not be available for all applications.Optimal conditions must be determined individually for each application.
Species Reactivity	Human
UniProt ID	O14798
Worry-free Guarantee	This antibody is covered by our Worry-Free Guarantee.

Handling	For maximum product recovery after thawing, centrifuge the vial before opening the cap. Avoid freeze/thaw cycles. After opening, prepare aliquots and store at -20°C.
Long Term Storage	-20°C
Shipping	Blue Ice

Regulatory Status	RUO – Research Use Only

Effects of androgen ablation therapy in TRAIL death ligand and its receptors expression in advanced prostate cancer: Koksal, I. T., Sanlioglu, A. D., et al.; Urol. Int. 84, 445 (2010), Abstract
High levels of endogenous tumor necrosis factor-related apoptosis-inducing ligand expression correlate with increased cell death in human pancreas: A.D. Sanlioglu, et al.; Pancreas 36, 385 (2008), Abstract — Full Text
Lack of tumor necrosis factor-related apoptosis-inducing ligand but presence of its receptors in the human brain: J. Dörr, et al.; J. Neurosci. 22, RC209 (2002), Abstract — Full Text
The cytokines tumor necrosis factor-alpha (TNF-alpha ) and TNF-related apoptosis-inducing ligand differentially modulate proliferation and apoptotic pathways in human keratinocytes expressing the human papillomavirus-16 E7 oncoprotein: J.R. Basile et al.; J. Biol. Chem. 276, 22522 (2001), Abstract — Full Text
Rel/NF-κB transcription factors protect against tumor necrosis factor (TNF)-related apoptosis-inducing ligand (TRAIL)-induced apoptosis by up-regulating the TRAIL decoy receptor DcR1: D. Bernard, et al.; J. Biol. Chem. 276, 27322 (2001), Abstract — Full Text
Sensitivity to TRAIL/APO-2L-mediated apoptosis in human renal cell carcinomas and its enhancement by topotecan: M. Dejosez, et al.; Cell Death Differ. 7, 1127 (2000), Abstract

Related Products

Alternative Name	TRAIL receptor 3, DcR1, Death Receptor 1, TRID, CD263, TNFRSF 10C, TNF-related apoptosis-inducing ligand receptor 3, Tumor necrosis factor receptor superfamily member 10C
Application	Flow Cytometry
Host	Mouse
Isotype	IgG1
Species Reactivity	Human

Please enter the lot number as featured on the product label

Lot No. :

Enzo Life Science provides GHS Compliant SDS

If your language is not available please fill out the SDS request form