Home Shop Toll-like receptor 5 (human) polyclonal antibody

Toll-like receptor 5 (human) polyclonal antibody

Already have an account?

Note: Human Toll-like Receptor 5 (TLR5) is also described as Toll/Interleukin-1 Receptor-like Gene 3 (TIL3).

Shipping: Available products typically ship within 24/48h, via priority shipping.

Do you need support? Contact Customer Service or Technical Support.

Online Account
Access or Create Your Account

This antibody is covered by our Worry-Free Guarantee.

Alternative Name	TLR5, Toll/Interleukin-1 receptor-like gene 3, TIL3
Application	ELISA, Flow Cytometry, IHC, WB
Formulation	Affinity purified antibody in 10 mM KHPO4, 140 mM NaCl, BSA @ 1mg/ml and 0.1% sodium azide.
Host	Goat
Immunogen	Synthetic peptide corresponding to aa 151-181 (D151LSKNQIRSLYLHPSFGKLNSLKSIDFSSNQ181) of human TLR5 (Toll-like receptor 5).
Purity Detail	Epitope-affinity purified IgG.
Quality Control	Immunocytochemistry on human peripheral blood leukocytes.
Recommendation Dilutions/Conditions	ELISA (1:37,500)Western Blotting (1:50)IHC (1:250)Flow Cytometry (1:200)Suggested dilutions/conditions may not be available for all applications.Optimal conditions must be determined individually for each application.
Species Reactivity	Human
UniProt ID	O60602
Worry-free Guarantee	This antibody is covered by our Worry-Free Guarantee.

Handling	For maximum product recovery after thawing, centrifuge the vial before opening the cap. Avoid freeze/thaw cycles. After opening, prepare aliquots and store at -20°C.
Short Term Storage	+4°C
Long Term Storage	-20°C
Shipping	Blue Ice

Regulatory Status	RUO – Research Use Only

Datasheet, Manuals, SDS & CofA

Please enter the lot number as featured on the product label

Lot No. :

Enzo Life Science provides GHS Compliant SDS

If your language is not available please fill out the SDS request form