Skip to main content

PDKtide (biotinylated)

BML-P251

  • BML-P251-0100   —   100 µg
    $235.00

This peptide, Biotin-Ahx[protein fragment, 39 aa], is derived from AKT1 and PKN2/PRK2. It is a substrate for PDK1, CDK9/Cyclin T1 and JAK2.The biotin allows peptide to be used in kinase assays with streptavidin-bound membranes.

Shipping: Available products typically ship within 24/48h, via priority shipping.

Do you need support? Contact Customer Service or Technical Support.

Online Account
Access or Create Your Account


Regulatory Status

RUO – Research Use Only


Last modified: May 29, 2024