
Shipping: Available products typically ship within 24/48h, via priority shipping.
Do you need support? Contact Customer Service or Technical Support.
Online Account
Access or Create Your Account
Regulatory Status |
RUO – Research Use Only |
---|
Shipping: Available products typically ship within 24/48h, via priority shipping.
Do you need support? Contact Customer Service or Technical Support.
Online Account
Access or Create Your Account
Application |
ELISA, WB |
---|---|
Host |
Rabbit |
Immunogen |
Synthetic peptide corresponding to amino acids 58-93 of Human E2F1.Sequence:PCDPDLLLFATPQAPRPTPSAPRPALGRPPVKRRLD |
Isotype |
IgG |
Purity Detail |
Affinity Purified |
Species Reactivity |
Human, Mouse, Rat |
UniProt ID |
Q01094 |
Regulatory Status |
RUO – Research Use Only |
---|
Do you want to visit the website?
The products in your cart will be removed.