Shipping: Available products typically ship within 24/48h, via priority shipping.
Do you need support? Contact Customer Service or Technical Support.
Online Account
Access or Create Your Account
| Regulatory Status |
RUO – Research Use Only |
|---|
Shipping: Available products typically ship within 24/48h, via priority shipping.
Do you need support? Contact Customer Service or Technical Support.
Online Account
Access or Create Your Account
| Application |
ELISA, IF, IHC, IP, WB |
|---|---|
| Host |
Rabbit |
| Immunogen |
Synthetic peptide corresponding to ACTH aa 138-176. Sequence:SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF |
| Isotype |
IgG |
| Purity Detail |
Affinity Purified |
| Species Reactivity |
Human, Monkey, Mouse, Rat |
| UniProt ID |
UPI00004EBE53 |
| Regulatory Status |
RUO – Research Use Only |
|---|
Do you want to visit the website?
The products in your cart will be removed.