
Shipping: Available products typically ship within 24/48h, via priority shipping.
Do you need support? Contact Customer Service or Technical Support.
Online Account
Access or Create Your Account
Regulatory Status |
RUO – Research Use Only |
---|
Shipping: Available products typically ship within 24/48h, via priority shipping.
Do you need support? Contact Customer Service or Technical Support.
Online Account
Access or Create Your Account
Application |
ELISA, IF, IHC, IP, WB |
---|---|
Host |
Rabbit |
Immunogen |
Synthetic peptide corresponding to ACTH aa 138-176. Sequence:SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF |
Isotype |
IgG |
Purity Detail |
Affinity Purified |
Species Reactivity |
Human, Monkey, Mouse, Rat |
UniProt ID |
UPI00004EBE53 |
Regulatory Status |
RUO – Research Use Only |
---|
Do you want to visit the website?
The products in your cart will be removed.